PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00027253001
Common NameGSBRNA2T00027253001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 454aa    MW: 50330 Da    PI: 7.6154
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00027253001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-39152212262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          k++a++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrn+PvGgg+rknk+s+
  GSBRNA2T00027253001 152 KDQAINCPRCNSVNTKFCYYNNYSLTQPRFFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSH 212
                          7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-29145204IPR003851Zinc finger, Dof-type
PfamPF027017.9E-33153210IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.416156210IPR003851Zinc finger, Dof-type
PROSITE patternPS013610158194IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MRIKVFVYFE YDKDSHSECF SSFIIQFSLS LSLSLPPTTP TLSHSTTPHI CYLFYILNIR  60
FFSLYPLSVC FFLFMFLVKA FLKFPNHLYL DEKLFILVGR VDFCDFDDQE IVVKPLEEIV  120
TNTCPTQQAS QPQPPPSVGA AGVAERKTRP EKDQAINCPR CNSVNTKFCY YNNYSLTQPR  180
FFCKGCRRYW TEGGSLRNIP VGGGSRKNKR SHSSSISSSS DISKNHSDST QPATKKHHSD  240
HHPHHHLMSI SQQGLTGQNP KTFETTQQDL NLGFPPHGLI RTNFTNLIHN TGNNNTSTNN  300
PFLGSSCSAT SALATSPLDL IRNNNCNNRN TSNSSFMGFP VHNQGPTSEG FSMQDHYKPS  360
NSNTTLLGFS LDHHHDNSEF HGGFQGGEGR EVGDDVNGRH LFPFEDLKLP VSSSSSATIN  420
IDVNDHQKRA SGGDAAATSG GYWTGMLSGG SWC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00027253001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625331.10.0PREDICTED: dof zinc finger protein DOF4.6-like
SwissprotQ8LAP81e-159DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A078GJL80.0A0A078GJL8_BRANA; BnaA08g15120D protein
STRINGBra010548.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-127Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]